PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.7V0I6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 534aa    MW: 59877.5 Da    PI: 7.1276
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.7V0I6genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.81.9e-11108149446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      W ++++ ll+++++++G g+W+ +a+++g ++  ++c++++++
      Aradu.7V0I6 108 WNADDEILLLEGIEMYGLGNWAEVAEHVG-TKNKESCIEHYRN 149
                      *****************************.***********99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250243.7E-15135534IPR016827Transcriptional adaptor 2
SMARTSM002911.4E-114489IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013511.0154491IPR000433Zinc finger, ZZ-type
PfamPF005691.6E-94788IPR000433Zinc finger, ZZ-type
SuperFamilySSF578509.54E-1548110No hitNo description
CDDcd023357.12E-274896No hitNo description
PROSITE patternPS0135705077IPR000433Zinc finger, ZZ-type
SuperFamilySSF466894.68E-12101154IPR009057Homeodomain-like
PROSITE profilePS5129321.924103155IPR017884SANT domain
SMARTSM007171.1E-10104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-7107150IPR009057Homeodomain-like
CDDcd001671.85E-11108150No hitNo description
PfamPF002495.4E-11108149IPR001005SANT/Myb domain
SuperFamilySSF466891.79E-18444531IPR009057Homeodomain-like
PROSITE profilePS5093411.613448534IPR007526SWIRM domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MGRSRGNFHH ADEDPSQRSR RKKNAASGEN LEPGAAGQGA SEGKRALYHC NYCNKDITGK  60
IRIKCAMCPD FDLCIECFSV GAEVTPHKSS HPYRVMDNLS FPLICADWNA DDEILLLEGI  120
EMYGLGNWAE VAEHVGTKNK ESCIEHYRNI YLNSPFFPLP DMSHVVGKNK KELLAMAKGQ  180
GEDKKGISMA DGLKEESTFS PSRVKVEDSH KAGSSGPNQK ASNSARGKDG LGVVKLEDSQ  240
VDRNFGGKKP NSSGNEGPSL VESSGYNSKR QEFDPEYDND AEQLLAEMEF KDADTDDERE  300
IKLRVLRIYA KRLDERKRRK DFILERNLLY PNSFEKDLTP EEKVICRRYD IFMRFHKKEE  360
HEELLRTVIS EHRTLKRLQD LKEARAAGCR NAAEAERYLL NKRRREADES TRRVKESAQG  420
GPSNQGVPNA LMSPDSASKD MSGRPAGPAT SSSVNEMDVT GYYGADLLSE PEKRLCCELR  480
LPPALYLKMQ EQLSLQILGG TISAKSDAHQ LFKMDAIKID RVYDMLIKKG IASP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1315320RKRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015958984.10.0PREDICTED: transcriptional adapter ADA2b
SwissprotQ9ATB40.0TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A0B2REG70.0A0A0B2REG7_GLYSO; Transcriptional adapter ADA2b
TrEMBLI1MFQ50.0I1MFQ5_SOYBN; Uncharacterized protein
STRINGGLYMA15G12400.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726